PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC043315.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family G2-like
Protein Properties Length: 431aa    MW: 46432.4 Da    PI: 7.7334
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC043315.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.55.4e-32203258156
       G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                   k+r++W+p+LH+rFv+a++ LGGs++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  EcC043315.10 203 KARRCWSPDLHRRFVNALQMLGGSQVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 258
                   68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.66E-17200261IPR009057Homeodomain-like
PROSITE profilePS5129413.355200260IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.9E-28201261IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-26203258IPR006447Myb domain, plants
PfamPF002497.3E-7205256IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009266Biological Processresponse to temperature stimulus
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0010452Biological Processhistone H3-K36 methylation
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:1903507Biological Processnegative regulation of nucleic acid-templated transcription
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 431 aa     Download sequence    Send to blast
KRELPLCMQL LTNAVEVSKQ QLQAYRANSG PKPVLEEFMP LKNSSSEGSE KTPNLSEKAS  60
WMISAQLWSQ TSNDSPNKQQ SLAPKETDIG FNVSPKFSLE NKSRNGGAFL PFSKERNGSC  120
PSPSLRALPE LALGSPDKEM EDKKYPEAEN GNGVSCVRRD GCSKIGNGEV GKGTVSSAEV  180
QIPATANASN TNTTAANGQT HRKARRCWSP DLHRRFVNAL QMLGGSQVAT PKQIRELMKV  240
DGLTNDEVKS HLQKYRLHTR RPSPSPQTAG SAAPQLVVLG GIWVPPDYAT AAAAAVAHGN  300
TSPLYGAHPS AHASPHYCTP PGMPQEFYSA AASHHEAVHH HPLHGHHHQI QVYKGTSHPQ  360
PQSSPESGMR GGGGDGQSES IEDGKSESSS WKGDSGDHVN GGDQRNGLIT MRDDNNEESN  420
GSEITLKFYD K
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00261DAPTransfer from AT2G03500Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010049950.10.0PREDICTED: transcription factor LUX isoform X2
TrEMBLA0A059CX250.0A0A059CX25_EUCGR; Uncharacterized protein
STRINGVIT_11s0016g04600.t011e-167(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM71342843
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.16e-94G2-like family protein